(data stored in ACNUC7421 zone)

EMBL: FM180568.PE696

FM180568.PE696       Location/Qualifiers
FT   CDS             746875..748803
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0696"
FT                   /product="predicted terminase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0696"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08244"
FT                   /db_xref="InterPro:IPR008866"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULU2"
FT                   /protein_id="CAS08244.1"
FT                   /translation="MNISEQQLNNMMSAVTTALQPLIRALPVTPVEWADQNYYLPKESS
FT                   YGEGEWKTLPFQIAIMNSMGNDQIRTVNLIKSARVGYTKMLLGVVGYFIEHKSRNSLLF
FT                   QPTDSAAEDFMKSHVEATIRNVPCLKDLSPWLGRKHRDNTLTLKRFSSGVGFWCLGGAA
FT                   AKNYREKSVDVVCYDELSSFEPDVEKEGSPTLLGDKRIEGSVWPKSIRGSTPKIKGTCQ
FT                   IEKAANESAHFMRFYVPCPHCGEAQYLKFGDESTPFGLKWEKDSPESVFYLCEHHGCVI
FT                   HQSELDQSNGRWICENTGMWTRDGLTFFSARGDEIPPPRSITFHIWTAYSPFTTWVQIV
FT                   YDWLDALKDPNGLKTFVNTTLGETWEEAVGEKLDHQVLMDKVVHYTAAVPARVVYLTAG
FT                   IDSQRNRFEMYVWGWAPGEEAFLVDKIIIMGRPDEEETLLRVDAAINKKYCHADGTEMT
FT                   ISRVCWDTGGIDGEIVYQRSKKHGVFRVLPVKGASVYGKPVITMPKTRNQRGVYLCEVG
FT                   TDTAKEILYARMKADPTPADEATSYAIRFPDDPEIFSQTEAQQLVAEELVEKWEKGKMR
FT                   LLWDNKKRRNEALDCLVYAYAALRVSVQRWQLDLAVLAKSREEETTRPTLKELAAKLSG
FT                   GVNGYSR"
     MNISEQQLNN MMSAVTTALQ PLIRALPVTP VEWADQNYYL PKESSYGEGE WKTLPFQIAI        60
     MNSMGNDQIR TVNLIKSARV GYTKMLLGVV GYFIEHKSRN SLLFQPTDSA AEDFMKSHVE       120
     ATIRNVPCLK DLSPWLGRKH RDNTLTLKRF SSGVGFWCLG GAAAKNYREK SVDVVCYDEL       180
     SSFEPDVEKE GSPTLLGDKR IEGSVWPKSI RGSTPKIKGT CQIEKAANES AHFMRFYVPC       240
     PHCGEAQYLK FGDESTPFGL KWEKDSPESV FYLCEHHGCV IHQSELDQSN GRWICENTGM       300
     WTRDGLTFFS ARGDEIPPPR SITFHIWTAY SPFTTWVQIV YDWLDALKDP NGLKTFVNTT       360
     LGETWEEAVG EKLDHQVLMD KVVHYTAAVP ARVVYLTAGI DSQRNRFEMY VWGWAPGEEA       420
     FLVDKIIIMG RPDEEETLLR VDAAINKKYC HADGTEMTIS RVCWDTGGID GEIVYQRSKK       480
     HGVFRVLPVK GASVYGKPVI TMPKTRNQRG VYLCEVGTDT AKEILYARMK ADPTPADEAT       540
     SYAIRFPDDP EIFSQTEAQQ LVAEELVEKW EKGKMRLLWD NKKRRNEALD CLVYAYAALR       600
     VSVQRWQLDL AVLAKSREEE TTRPTLKELA AKLSGGVNGY SR                          642
//

If you have problems or comments...

PBIL Back to PBIL home page