(data stored in ACNUC7421 zone)

EMBL: FM180568.PE698

FM180568.PE698       Location/Qualifiers
FT   CDS             748990..750582
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0698"
FT                   /product="predicted portal protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0698"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08246"
FT                   /db_xref="GOA:B7ULU4"
FT                   /db_xref="InterPro:IPR006429"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULU4"
FT                   /protein_id="CAS08246.1"
FT                   /translation="MKRTPVLIDVNGVPLRESLSYNGGGAGFGGQMAEWLPPAQSADAA
FT                   LLPALRLGNARADDLVRNNGIAANAVALHKDHIVGHMFLISYRPNWRWLGMRETAAKSF
FT                   VDEVEAAWSEYAEGMSGEIDVEGKRTFTEFIREGVGVHAFNGEIFVQPVWDTESTQLFR
FT                   TRFKAVSPKRVDTPGHGMGNRFLRAGVEVDRYGRAVAYHICEDDFPFSGSGRWERIPRE
FT                   LPTGRPAMLHIFEPVEDGQTRGANQFYSVMERLKMLDSLQATQLQSAIVKAMYAATIES
FT                   DLDTEKAFEYIAGAPQGQKDNPLINILDKFSTWYDTNSVTLGGVKIPHLFPGDDLKLQT
FT                   AQDSDNGFSALEQALLRYIAAGLGVSYEQLSRDYSKVSYSSARASANESWRYFMGRRKF
FT                   IASRLATQMFSCWLEEALLRGIIRPPRARFDFYQARSAWSRAEWIGAGRMAIDGLKEVQ
FT                   ESVMRIEAGLSTYEKELALMGEDYQDIFRQQVRESAERQKAGLSRPVWIAQAYEQQIAE
FT                   SRRPEEETTPRET"
     MKRTPVLIDV NGVPLRESLS YNGGGAGFGG QMAEWLPPAQ SADAALLPAL RLGNARADDL        60
     VRNNGIAANA VALHKDHIVG HMFLISYRPN WRWLGMRETA AKSFVDEVEA AWSEYAEGMS       120
     GEIDVEGKRT FTEFIREGVG VHAFNGEIFV QPVWDTESTQ LFRTRFKAVS PKRVDTPGHG       180
     MGNRFLRAGV EVDRYGRAVA YHICEDDFPF SGSGRWERIP RELPTGRPAM LHIFEPVEDG       240
     QTRGANQFYS VMERLKMLDS LQATQLQSAI VKAMYAATIE SDLDTEKAFE YIAGAPQGQK       300
     DNPLINILDK FSTWYDTNSV TLGGVKIPHL FPGDDLKLQT AQDSDNGFSA LEQALLRYIA       360
     AGLGVSYEQL SRDYSKVSYS SARASANESW RYFMGRRKFI ASRLATQMFS CWLEEALLRG       420
     IIRPPRARFD FYQARSAWSR AEWIGAGRMA IDGLKEVQES VMRIEAGLST YEKELALMGE       480
     DYQDIFRQQV RESAERQKAG LSRPVWIAQA YEQQIAESRR PEEETTPRET                  530
//

If you have problems or comments...

PBIL Back to PBIL home page