(data stored in ACNUC7421 zone)

EMBL: FM180568.PE699

FM180568.PE699       Location/Qualifiers
FT   CDS             750572..752077
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0699"
FT                   /product="predicted head protein/prohead protease"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0699"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08247"
FT                   /db_xref="GOA:B7ULU5"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033855"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULU5"
FT                   /protein_id="CAS08247.1"
FT                   /translation="MRRNLSHIIAAAFNEPLLLEPAYARVFFCALGREMGASSLSVPQQ
FT                   QVQFDAPGMLAETDEYMAGGKRPARVYRVVNGIAVLPVTGTLVHRLGGMRPFSGMTGYD
FT                   GIVACLQQAMADSQVRGVLLDIDSPGGQAAGAFDCADMIYRLRQQKPVWALCNDTACSA
FT                   AMLLASACSRRLVTQTSRIGSIGVMMSHVSYAGHLAQAGVDITLIYSGAHKVDGNQFEA
FT                   LPAEVRQDMQQRIDAARRMFAEKVAMFTGLSVDAVTGTEAAVFEGQSGIDAGLADELVN
FT                   ASDAISVMATALNSNVRGGTMPQLTATEAAAQENQRVMGILTCQEAKGREQLATMLAGQ
FT                   QGMSVEQARAILAAAAPQQPVASTQSEADRIMACEEANGREQLAATLAAMPEMTVEKAR
FT                   PILAASPQADAGPSLRDQIMALDEAKGAEAQAEQLAACPGMTVESARAVLAAGSGKAEP
FT                   VSASTTALFERIMANHSPAAVQGGVPQTSADGDADVKMLMAMP"
     MRRNLSHIIA AAFNEPLLLE PAYARVFFCA LGREMGASSL SVPQQQVQFD APGMLAETDE        60
     YMAGGKRPAR VYRVVNGIAV LPVTGTLVHR LGGMRPFSGM TGYDGIVACL QQAMADSQVR       120
     GVLLDIDSPG GQAAGAFDCA DMIYRLRQQK PVWALCNDTA CSAAMLLASA CSRRLVTQTS       180
     RIGSIGVMMS HVSYAGHLAQ AGVDITLIYS GAHKVDGNQF EALPAEVRQD MQQRIDAARR       240
     MFAEKVAMFT GLSVDAVTGT EAAVFEGQSG IDAGLADELV NASDAISVMA TALNSNVRGG       300
     TMPQLTATEA AAQENQRVMG ILTCQEAKGR EQLATMLAGQ QGMSVEQARA ILAAAAPQQP       360
     VASTQSEADR IMACEEANGR EQLAATLAAM PEMTVEKARP ILAASPQADA GPSLRDQIMA       420
     LDEAKGAEAQ AEQLAACPGM TVESARAVLA AGSGKAEPVS ASTTALFERI MANHSPAAVQ       480
     GGVPQTSADG DADVKMLMAM P                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page