(data stored in ACNUC7421 zone)

EMBL: FM180568.PE70

FM180568.PE70        Location/Qualifiers
FT   CDS             77019..78506
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0070"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07618"
FT                   /db_xref="GOA:B7UIB5"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIB5"
FT                   /protein_id="CAS07618.1"
FT                   /translation="MDIFIQALTYINLNAILAIIAATAFGLFVGAIPGLTATMAVALMV
FT                   PFTFFLDPIPALALMIAVGASSIYAGDIPGALLRIPGTPASAAYVADSNELVKQGKVNR
FT                   VLGLGLVSSVIGGVIGSLILMLAAPVLAKFALKFSSYEYTWLSLLGLTCATLVVGNQPL
FT                   KGMVTLCLGLLLACIGYDQISGVPRFTFGQISLLQGVNFIPAMIGLFAISGAIEYYRDK
FT                   ISQVSGAVPQTQTGINLFKGMGQVIWSRKLNLGRSSIIGTLIGALPGAGADIAAWISYA
FT                   ISKKFSRQQELYGHGSEEAIVDSSSSNNASLAGSWIPSLVFGIPGDSAAAIIIGVLYMK
FT                   DMNPGPTLFLFQADKLYAVFILFLIANIALLPLATIAVSFIKRIIWIDKAILYPIILIF
FT                   SIVGAFAIDNSGASVVVMLVMGVLGYWLQRKEYPVSPIILGMILGPMLEKNLLSSMIKS
FT                   NGEWLAFVERPVSMALAVCFFLVVALQGRNIYRSFSR"
     MDIFIQALTY INLNAILAII AATAFGLFVG AIPGLTATMA VALMVPFTFF LDPIPALALM        60
     IAVGASSIYA GDIPGALLRI PGTPASAAYV ADSNELVKQG KVNRVLGLGL VSSVIGGVIG       120
     SLILMLAAPV LAKFALKFSS YEYTWLSLLG LTCATLVVGN QPLKGMVTLC LGLLLACIGY       180
     DQISGVPRFT FGQISLLQGV NFIPAMIGLF AISGAIEYYR DKISQVSGAV PQTQTGINLF       240
     KGMGQVIWSR KLNLGRSSII GTLIGALPGA GADIAAWISY AISKKFSRQQ ELYGHGSEEA       300
     IVDSSSSNNA SLAGSWIPSL VFGIPGDSAA AIIIGVLYMK DMNPGPTLFL FQADKLYAVF       360
     ILFLIANIAL LPLATIAVSF IKRIIWIDKA ILYPIILIFS IVGAFAIDNS GASVVVMLVM       420
     GVLGYWLQRK EYPVSPIILG MILGPMLEKN LLSSMIKSNG EWLAFVERPV SMALAVCFFL       480
     VVALQGRNIY RSFSR                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page