(data stored in ACNUC7421 zone)

EMBL: FM180568.PE700

FM180568.PE700       Location/Qualifiers
FT   CDS             752114..752461
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0700"
FT                   /product="predicted head-DNA stabilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0700"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08248"
FT                   /db_xref="InterPro:IPR004195"
FT                   /db_xref="InterPro:IPR036630"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULU6"
FT                   /protein_id="CAS08248.1"
FT                   /translation="MVTKTITEQRAEVRIFAGNDPAHTATGSSGISSATPALTPLMLDE
FT                   ATGKLVVWDGQKAGSAVGILVLPLEGTETALTYYKSGTFATEAIRWPESVDEHKKANAF
FT                   AGSALSHAALP"
     MVTKTITEQR AEVRIFAGND PAHTATGSSG ISSATPALTP LMLDEATGKL VVWDGQKAGS        60
     AVGILVLPLE GTETALTYYK SGTFATEAIR WPESVDEHKK ANAFAGSALS HAALP            115
//

If you have problems or comments...

PBIL Back to PBIL home page