(data stored in ACNUC7421 zone)

EMBL: FM180568.PE701

FM180568.PE701       Location/Qualifiers
FT   CDS             752519..753547
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0701"
FT                   /product="predicted major capsid protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0701"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08249"
FT                   /db_xref="InterPro:IPR005564"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULU7"
FT                   /protein_id="CAS08249.1"
FT                   /translation="MGLFTTRQLLGYTEQKVKFRALFLELFFRRTVNFHTEEVMLDKIT
FT                   GKTPVAAYVSPVVEGKVLRHRGGETRVLRPGYVKPKHEFNYQQAVERLPGEDPAQLNDP
FT                   AYRRLRIITDNLKQEEHAIVQVEEMQAVNAVLYGKYTMEGDQFEKIEVDFGRSTKNNIT
FT                   QGSGKEWSKQDRDTFDPTHDLDLYCDQASGLVNIAIMDGTVWRLLNGFKLFREKLDTRR
FT                   GSNSQLETAVKDLGAVVSFKGYYGDLAIVVAKTSYVAEDGTEKRYLPEGSLVLGNTAAE
FT                   GIRCYGAIQDAQALSEGVVASSRYPKHWLTVGDPAREFTMTQSAPLMVLPDPDEFVVVQ
FT                   VK"
     MGLFTTRQLL GYTEQKVKFR ALFLELFFRR TVNFHTEEVM LDKITGKTPV AAYVSPVVEG        60
     KVLRHRGGET RVLRPGYVKP KHEFNYQQAV ERLPGEDPAQ LNDPAYRRLR IITDNLKQEE       120
     HAIVQVEEMQ AVNAVLYGKY TMEGDQFEKI EVDFGRSTKN NITQGSGKEW SKQDRDTFDP       180
     THDLDLYCDQ ASGLVNIAIM DGTVWRLLNG FKLFREKLDT RRGSNSQLET AVKDLGAVVS       240
     FKGYYGDLAI VVAKTSYVAE DGTEKRYLPE GSLVLGNTAA EGIRCYGAIQ DAQALSEGVV       300
     ASSRYPKHWL TVGDPAREFT MTQSAPLMVL PDPDEFVVVQ VK                          342
//

If you have problems or comments...

PBIL Back to PBIL home page