(data stored in ACNUC7421 zone)

EMBL: FM180568.PE702

FM180568.PE702       Location/Qualifiers
FT   CDS             753599..753973
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0702"
FT                   /product="predicted DNA packaging protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0702"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08250"
FT                   /db_xref="InterPro:IPR025147"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULU8"
FT                   /protein_id="CAS08250.1"
FT                   /translation="MATKEQNLKRLDELALILGREPDISGSAAEIAQRVAEWEEEMQSS
FT                   GDDVQVMNMDIRERENAAHDVREETSGALTRIRVLTCLHLCGVDGETGESVELADVGRV
FT                   ILIMSSDAKTHVDGGMAVYA"
     MATKEQNLKR LDELALILGR EPDISGSAAE IAQRVAEWEE EMQSSGDDVQ VMNMDIRERE        60
     NAAHDVREET SGALTRIRVL TCLHLCGVDG ETGESVELAD VGRVILIMSS DAKTHVDGGM       120
     AVYA                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page