(data stored in ACNUC7421 zone)

EMBL: FM180568.PE704

FM180568.PE704       Location/Qualifiers
FT   CDS             754334..754867
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0704"
FT                   /product="predicted minor tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0704"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08252"
FT                   /db_xref="InterPro:IPR010633"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULV0"
FT                   /protein_id="CAS08252.1"
FT                   /translation="MAIKGLDQAIENLSRVRKNAIPAASAMAINRVATTAINQSSSQVA
FT                   RETRVSRKLVKERSRLKRATVRNPNARIIVNRGDLPVIKLGIRMPGRRPDSILKAGQHR
FT                   YQRAFIQRLKNGRWHVMQRVVGKNRYPIDVVKIPMAAPLKQAFDENVDRIRRERLPGEL
FT                   AYALKQQLRIAIKR"
     MAIKGLDQAI ENLSRVRKNA IPAASAMAIN RVATTAINQS SSQVARETRV SRKLVKERSR        60
     LKRATVRNPN ARIIVNRGDL PVIKLGIRMP GRRPDSILKA GQHRYQRAFI QRLKNGRWHV       120
     MQRVVGKNRY PIDVVKIPMA APLKQAFDEN VDRIRRERLP GELAYALKQQ LRIAIKR          177
//

If you have problems or comments...

PBIL Back to PBIL home page