(data stored in ACNUC7421 zone)

EMBL: FM180568.PRFH

FM180568.PRFH        Location/Qualifiers
FT   CDS             260893..261474
FT                   /transl_table=11
FT                   /gene="prfH"
FT                   /locus_tag="E2348C_0229"
FT                   /product="predicted peptide chain release factor"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07777"
FT                   /db_xref="GOA:B7UJC4"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR017509"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJC4"
FT                   /protein_id="CAS07777.1"
FT                   /translation="MILLQLSSAQGPEECCLAVKKALDRLIKEAARQDVAVTVLETETG
FT                   RYSDTLRSALVSLDGDNAWALSESWCGTIQWICPSPYRPHHGRKNWFLGIGRFTADEQE
FT                   QSDAIRYETLRSSGPGGQHVNKTDSAVRATHLASGISVKVQSERSQHANKRLARLLIAW
FT                   KLEQQQQENSAALKSQRRMFHHQIERGNPR"
     MILLQLSSAQ GPEECCLAVK KALDRLIKEA ARQDVAVTVL ETETGRYSDT LRSALVSLDG        60
     DNAWALSESW CGTIQWICPS PYRPHHGRKN WFLGIGRFTA DEQEQSDAIR YETLRSSGPG       120
     GQHVNKTDSA VRATHLASGI SVKVQSERSQ HANKRLARLL IAWKLEQQQQ ENSAALKSQR       180
     RMFHHQIERG NPR                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page