(data stored in ACNUC7421 zone)

EMBL: FM180568.PRIC

FM180568.PRIC        Location/Qualifiers
FT   CDS             complement(450762..451289)
FT                   /transl_table=11
FT                   /gene="priC"
FT                   /locus_tag="E2348C_0402"
FT                   /product="primosomal replication protein N''"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07950"
FT                   /db_xref="InterPro:IPR010890"
FT                   /db_xref="InterPro:IPR038338"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKE7"
FT                   /protein_id="CAS07950.1"
FT                   /translation="MKTTLLLEKLEGQLATLRQRCAPVAQFATLSARFDRHLFQTRATT
FT                   LQACLDEAGDNLAALRHAVEQQQLPQVAWLAEHLAAQLEAIAREATAWSLREWDSAPPK
FT                   IARWQRKRIQHQDFERRLREMVAERRARLARATALVEQQTLHREVEAYEARLARCRHAL
FT                   EKIENRLARLTR"
     MKTTLLLEKL EGQLATLRQR CAPVAQFATL SARFDRHLFQ TRATTLQACL DEAGDNLAAL        60
     RHAVEQQQLP QVAWLAEHLA AQLEAIAREA TAWSLREWDS APPKIARWQR KRIQHQDFER       120
     RLREMVAERR ARLARATALV EQQTLHREVE AYEARLARCR HALEKIENRL ARLTR            175
//

If you have problems or comments...

PBIL Back to PBIL home page