(data stored in ACNUC7421 zone)

EMBL: FM180568.PRPE

FM180568.PRPE        Location/Qualifiers
FT   CDS             331130..332941
FT                   /transl_table=11
FT                   /gene="prpE"
FT                   /locus_tag="E2348C_0294"
FT                   /product="predicted propionyl-CoA synthetase with ATPase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07842"
FT                   /db_xref="GOA:B7UJI4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR012694"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJI4"
FT                   /protein_id="CAS07842.1"
FT                   /translation="MSFSEFYQRSINEPEQFWAEQARRIDWQTPFTQTLDHSNPPFARW
FT                   FCEGRTNLCHNAIDRWLEKQPGALALIAVSSETEEERTFTFRQLHDEVNAVASMLRSLG
FT                   VQRGDRVLVYMPMIAEAHITLLACARIGAIHSVVFGGFASHSVAARIDDAKPVLIVSAD
FT                   AGARGGKIIPYKKLLDDAISQAQHQPRHVLLVDRGLAKMARVSGRDVDFASLRHQHIGA
FT                   RVPVAWLESNETSCILYTSGTTGKPKGVQRDVGGYAVALATSMDTIFGGKAGGVFFCAS
FT                   DIGWVVGHSYIVYAPLLAGMATIVYEGLPTWPDCGVWWKIVEKYQVSRMFSAPTAIRVL
FT                   KKFPTAEIRKHDLSSLEVLYLAGEPLDEPTASWVSNTLDVPVIDNYWQTESGWPIMAIA
FT                   RGLDDRPTRLGSPGVPMYGYNVQLLNEVTGEPCGVNEKGMLVVEGPLPPGCIQTIWGDD
FT                   DRFVKTYWSLFSRPVYATFDWGIRDADGYHFILGRTDDVINVAGHRLGTREIEESISSH
FT                   PVVAEVAVVGVKDALKGQVAVAFVIPKESDSLEDREVAHSQEKAIMALVDSQIGNFGRP
FT                   AHVWFVSQLPKTRSGKMLRRTIQAMEE"
     MSFSEFYQRS INEPEQFWAE QARRIDWQTP FTQTLDHSNP PFARWFCEGR TNLCHNAIDR        60
     WLEKQPGALA LIAVSSETEE ERTFTFRQLH DEVNAVASML RSLGVQRGDR VLVYMPMIAE       120
     AHITLLACAR IGAIHSVVFG GFASHSVAAR IDDAKPVLIV SADAGARGGK IIPYKKLLDD       180
     AISQAQHQPR HVLLVDRGLA KMARVSGRDV DFASLRHQHI GARVPVAWLE SNETSCILYT       240
     SGTTGKPKGV QRDVGGYAVA LATSMDTIFG GKAGGVFFCA SDIGWVVGHS YIVYAPLLAG       300
     MATIVYEGLP TWPDCGVWWK IVEKYQVSRM FSAPTAIRVL KKFPTAEIRK HDLSSLEVLY       360
     LAGEPLDEPT ASWVSNTLDV PVIDNYWQTE SGWPIMAIAR GLDDRPTRLG SPGVPMYGYN       420
     VQLLNEVTGE PCGVNEKGML VVEGPLPPGC IQTIWGDDDR FVKTYWSLFS RPVYATFDWG       480
     IRDADGYHFI LGRTDDVINV AGHRLGTREI EESISSHPVV AEVAVVGVKD ALKGQVAVAF       540
     VIPKESDSLE DREVAHSQEK AIMALVDSQI GNFGRPAHVW FVSQLPKTRS GKMLRRTIQA       600
     MEE                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page