(data stored in ACNUC7421 zone)

EMBL: FM180568.PSIF

FM180568.PSIF        Location/Qualifiers
FT   CDS             362437..362757
FT                   /transl_table=11
FT                   /gene="psiF"
FT                   /locus_tag="E2348C_0320"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07868"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJK8"
FT                   /protein_id="CAS07868.1"
FT                   /translation="MKITLLVTLLFGLVFLTTVGAAERTLTPQQQRMTSCNQQATAQAL
FT                   KGDARKTYMSDCLKNSKSAPGEKSLTPQQQKMRECNNQATQQSLKGDDRNKFMSACLKK
FT                   AA"
     MKITLLVTLL FGLVFLTTVG AAERTLTPQQ QRMTSCNQQA TAQALKGDAR KTYMSDCLKN        60
     SKSAPGEKSL TPQQQKMREC NNQATQQSLK GDDRNKFMSA CLKKAA                      106
//

If you have problems or comments...

PBIL Back to PBIL home page