(data stored in ACNUC7421 zone)

EMBL: FM180568.PYRH

FM180568.PYRH        Location/Qualifiers
FT   CDS             201861..202586
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="E2348C_0176"
FT                   /product="uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07724"
FT                   /db_xref="GOA:B7UIL6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIL6"
FT                   /protein_id="CAS07724.1"
FT                   /translation="MATNAKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELV
FT                   ELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARL
FT                   MSAIPLNGVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEADVVLK
FT                   ATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNK
FT                   PGALRRVVMGEKEGTLITE"
     MATNAKPVYK RILLKLSGEA LQGTEGFGID ASILDRMAQE IKELVELGIQ VGVVIGGGNL        60
     FRGAGLAKAG MNRVVGDHMG MLATVMNGLA MRDALHRAYV NARLMSAIPL NGVCDSYSWA       120
     EAISLLRNNR VVILSAGTGN PFFTTDSAAC LRGIEIEADV VLKATKVDGV FTADPAKDPT       180
     ATMYEQLTYS EVLEKELKVM DLAAFTLARD HKLPIRVFNM NKPGALRRVV MGEKEGTLIT       240
     E                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page