(data stored in ACNUC7421 zone)

EMBL: FM180568.QUEC

FM180568.QUEC        Location/Qualifiers
FT   CDS             complement(423769..424464)
FT                   /transl_table=11
FT                   /gene="queC"
FT                   /locus_tag="E2348C_0379"
FT                   /product="predicted aluminum resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07927"
FT                   /db_xref="GOA:B7UJR7"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UJR7"
FT                   /protein_id="CAS07927.1"
FT                   /translation="MKRAVVVFSGGQDSTTCLVQALQQYDEVHCVTFDYGQRHRAEIDV
FT                   ARELALKLGARAHKVLDVTLLNELAVSSLTRDSIPVPDYEPEADGIPNTFVPGRNILFL
FT                   TLAAIYAYQVKAEAVITGVCETDFSGYPDCRDEFVKALNHAVSLGMAKDIRFETPLMWI
FT                   DKAETWALADYYGKLDLVRNETLTCYNGIKGDGCGHCAACNLRANGLNHYLADKPTVMA
FT                   AIKQKTGLK"
     MKRAVVVFSG GQDSTTCLVQ ALQQYDEVHC VTFDYGQRHR AEIDVARELA LKLGARAHKV        60
     LDVTLLNELA VSSLTRDSIP VPDYEPEADG IPNTFVPGRN ILFLTLAAIY AYQVKAEAVI       120
     TGVCETDFSG YPDCRDEFVK ALNHAVSLGM AKDIRFETPL MWIDKAETWA LADYYGKLDL       180
     VRNETLTCYN GIKGDGCGHC AACNLRANGL NHYLADKPTV MAAIKQKTGL K                231
//

If you have problems or comments...

PBIL Back to PBIL home page