(data stored in ACNUC7421 zone)

EMBL: FM180568.RCSF

FM180568.RCSF        Location/Qualifiers
FT   CDS             complement(229546..229950)
FT                   /transl_table=11
FT                   /gene="rcsF"
FT                   /locus_tag="E2348C_0202"
FT                   /product="predicted outer membrane protein RcsF"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07750"
FT                   /db_xref="GOA:B7UJ98"
FT                   /db_xref="InterPro:IPR030852"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJ98"
FT                   /protein_id="CAS07750.1"
FT                   /translation="MRALPICLVALMLSGCSMLSRSPVEPVQSTAPQPKAEPAKPKAPR
FT                   ATPVRIYTNAEELVGKPFRDLGEVSGDSCQASNQDSPPSIPTARKRMQINASKMKANAV
FT                   LLHSCEVTSGTPGCYRQAVCIGSALNITAK"
     MRALPICLVA LMLSGCSMLS RSPVEPVQST APQPKAEPAK PKAPRATPVR IYTNAEELVG        60
     KPFRDLGEVS GDSCQASNQD SPPSIPTARK RMQINASKMK ANAVLLHSCE VTSGTPGCYR       120
     QAVCIGSALN ITAK                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page