(data stored in ACNUC7421 zone)

EMBL: FM180568.SDHC

FM180568.SDHC        Location/Qualifiers
FT   CDS             669503..669892
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="E2348C_0601"
FT                   /product="succinate dehydrogenase, membrane subunit, binds
FT                   cytochrome b556"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0601"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08149"
FT                   /db_xref="GOA:B7ULJ8"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULJ8"
FT                   /protein_id="CAS08149.1"
FT                   /translation="MIRNVKKQRPVNLDLQTIRFPVTAIASILHRVSGVITFVAVGILL
FT                   WLLGTSLSSPEGFEQASAIMGSFFVKFIMWGILTALAYHVVVGIRHMMMDFGYLEETFE
FT                   AGKRSAKISFVITVVFSLLAGVLVW"
     MIRNVKKQRP VNLDLQTIRF PVTAIASILH RVSGVITFVA VGILLWLLGT SLSSPEGFEQ        60
     ASAIMGSFFV KFIMWGILTA LAYHVVVGIR HMMMDFGYLE ETFEAGKRSA KISFVITVVF       120
     SLLAGVLVW                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page