(data stored in ACNUC7421 zone)

EMBL: FM180568.SDHD

FM180568.SDHD        Location/Qualifiers
FT   CDS             669886..670233
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="E2348C_0602"
FT                   /product="succinate dehydrogenase, membrane subunit, binds
FT                   cytochrome b556"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0602"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08150"
FT                   /db_xref="GOA:B7ULJ9"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULJ9"
FT                   /protein_id="CAS08150.1"
FT                   /translation="MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTY
FT                   EVWIGFFASAFTKVFTLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVY
FT                   VIYGFVVVWGV"
     MVSNASALGR NGVHDFILVR ATAIVLTLYI IYMVGFFATS GELTYEVWIG FFASAFTKVF        60
     TLLALFSILI HAWIGMWQVL TDYVKPLALR LMLQLVIVVA LVVYVIYGFV VVWGV            115
//

If you have problems or comments...

PBIL Back to PBIL home page