(data stored in ACNUC7421 zone)

EMBL: FM180568.SUCC

FM180568.SUCC        Location/Qualifiers
FT   CDS             677170..678336
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /locus_tag="E2348C_0607"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0607"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08155"
FT                   /db_xref="GOA:B7ULK4"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULK4"
FT                   /protein_id="CAS08155.1"
FT                   /translation="MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVV
FT                   KCQVHAGGRGKAGGVKVVNSKEDIRAFAENWLGKRLVTYQTDANGQPVNQILVEAATDI
FT                   AKELYLGAVVDRSSRRVVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPMPYQGREL
FT                   AFKLGLEGKLVQQFTKIFMGLATIFLERDLALIEINPLVITKQGDLVCLDGKLGADGNA
FT                   LFRQPDLREMRDQSQEDPREAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGG
FT                   EPANFLDVGGGATKERVTEAFKIILSDDKVKAVLVNIFGGIVRCDLIADGIIGAVAEVG
FT                   VNVPVVVRLEGNNAELGAKKLADSGLNIIAAKGLTDAAQQVVAAVEGK"
     MNLHEYQAKQ LFARYGLPAP VGYACTTPRE AEEAASKIGA GPWVVKCQVH AGGRGKAGGV        60
     KVVNSKEDIR AFAENWLGKR LVTYQTDANG QPVNQILVEA ATDIAKELYL GAVVDRSSRR       120
     VVFMASTEGG VEIEKVAEET PHLIHKVALD PLTGPMPYQG RELAFKLGLE GKLVQQFTKI       180
     FMGLATIFLE RDLALIEINP LVITKQGDLV CLDGKLGADG NALFRQPDLR EMRDQSQEDP       240
     REAQAAQWEL NYVALDGNIG CMVNGAGLAM GTMDIVKLHG GEPANFLDVG GGATKERVTE       300
     AFKIILSDDK VKAVLVNIFG GIVRCDLIAD GIIGAVAEVG VNVPVVVRLE GNNAELGAKK       360
     LADSGLNIIA AKGLTDAAQQ VVAAVEGK                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page