(data stored in ACNUC7421 zone)

EMBL: FM180568.TAUA

FM180568.TAUA        Location/Qualifiers
FT   CDS             345698..346660
FT                   /transl_table=11
FT                   /gene="tauA"
FT                   /locus_tag="E2348C_0305"
FT                   /product="taurine transporter subunit TauA"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07853"
FT                   /db_xref="GOA:B7UJJ5"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJJ5"
FT                   /protein_id="CAS07853.1"
FT                   /translation="MAISSRNTLLAALAFIAFQAQAVNVTVAYQTSAEPAKVAQADNTF
FT                   AKESGATVDWRKFDSGASIVRALASGDVQIGNLGSSPLAVATSQQVPIEVFLLASKLGN
FT                   SEALVVKKTISKPEDLIGKRIAVPFISTTHYSLLAALKHWGIKPGQVEIVNLQPPAIIA
FT                   AWQRGDIDGAYVWAPAVNALEKDGKVLTDSEQVGQWGAPTLDVWVVRKDFAEKHPEVVK
FT                   AFAKSAIDAQQPYIANPEAWLKQPENISKLARLSGVPEGDVPGLVKGNTYLTPKQQTAE
FT                   LTGPVNKAIIDTAQFLKEQGKVPAVANDYSQYVTSRFVQ"
     MAISSRNTLL AALAFIAFQA QAVNVTVAYQ TSAEPAKVAQ ADNTFAKESG ATVDWRKFDS        60
     GASIVRALAS GDVQIGNLGS SPLAVATSQQ VPIEVFLLAS KLGNSEALVV KKTISKPEDL       120
     IGKRIAVPFI STTHYSLLAA LKHWGIKPGQ VEIVNLQPPA IIAAWQRGDI DGAYVWAPAV       180
     NALEKDGKVL TDSEQVGQWG APTLDVWVVR KDFAEKHPEV VKAFAKSAID AQQPYIANPE       240
     AWLKQPENIS KLARLSGVPE GDVPGLVKGN TYLTPKQQTA ELTGPVNKAI IDTAQFLKEQ       300
     GKVPAVANDY SQYVTSRFVQ                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page