(data stored in ACNUC7421 zone)

EMBL: FM180568.TAUB

FM180568.TAUB        Location/Qualifiers
FT   CDS             346673..347440
FT                   /transl_table=11
FT                   /gene="tauB"
FT                   /locus_tag="E2348C_0306"
FT                   /product="taurine transporter subunit TauB"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07854"
FT                   /db_xref="GOA:B7UJJ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015859"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJJ6"
FT                   /protein_id="CAS07854.1"
FT                   /translation="MLQISHLYADYGGKPALEDINLTLESGELLVVLGPSGCGKTTLLN
FT                   LIAGFVPYQHGSIQLAGKGIQGPGAERGVVFQNEGLLPWRNVKDNVAFGLQLAGVEKMQ
FT                   RLEIAHQMVKKVGLEGAEKRYIWQLSGGQRQRVGIARALAANPQLLLLDEPFGALDAFT
FT                   RDQMQTLLLKLWQETGKQVLLITHDIEEAVFMATELVLLSSGPGRVLERLQLNFARRFV
FT                   AGESSRSIKSDPQFIAMREYVLSRVFEQREAFS"
     MLQISHLYAD YGGKPALEDI NLTLESGELL VVLGPSGCGK TTLLNLIAGF VPYQHGSIQL        60
     AGKGIQGPGA ERGVVFQNEG LLPWRNVKDN VAFGLQLAGV EKMQRLEIAH QMVKKVGLEG       120
     AEKRYIWQLS GGQRQRVGIA RALAANPQLL LLDEPFGALD AFTRDQMQTL LLKLWQETGK       180
     QVLLITHDIE EAVFMATELV LLSSGPGRVL ERLQLNFARR FVAGESSRSI KSDPQFIAMR       240
     EYVLSRVFEQ REAFS                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page