(data stored in ACNUC7421 zone)

EMBL: FM180568.TAUC

FM180568.TAUC        Location/Qualifiers
FT   CDS             347437..348264
FT                   /transl_table=11
FT                   /gene="tauC"
FT                   /locus_tag="E2348C_0307"
FT                   /product="taurine transporter subunit TauC, membrane
FT                   component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07855"
FT                   /db_xref="GOA:B7UJJ7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJJ7"
FT                   /protein_id="CAS07855.1"
FT                   /translation="MSVLINEKLHSHRLKWRWPLSRQVTLSIGTLAVLLTVWWAVAALQ
FT                   LISPLFLPPPQQVLAKLLTIAGPQGFMDATLWQHLAASLTRILLALLAAVLIGIPVGIA
FT                   MGLSPTVRGILDPIIELYRPVPPLAYLPLMVIWFGIGETSKILLIYLAIFAPVAMSALA
FT                   GVKSAQQVRIRAAQSLGASRAQVLWFVILPGALPEILTGLRIGLGVGWSTLVAAELIAA
FT                   TRGLGFMVQSAGEFLATDVVLAGIAVIAIIAFLLELGLRALQRRLTPWHGEVQ"
     MSVLINEKLH SHRLKWRWPL SRQVTLSIGT LAVLLTVWWA VAALQLISPL FLPPPQQVLA        60
     KLLTIAGPQG FMDATLWQHL AASLTRILLA LLAAVLIGIP VGIAMGLSPT VRGILDPIIE       120
     LYRPVPPLAY LPLMVIWFGI GETSKILLIY LAIFAPVAMS ALAGVKSAQQ VRIRAAQSLG       180
     ASRAQVLWFV ILPGALPEIL TGLRIGLGVG WSTLVAAELI AATRGLGFMV QSAGEFLATD       240
     VVLAGIAVIA IIAFLLELGL RALQRRLTPW HGEVQ                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page