(data stored in ACNUC7421 zone)

EMBL: FM180568.TBPA

FM180568.TBPA        Location/Qualifiers
FT   CDS             complement(81836..82819)
FT                   /transl_table=11
FT                   /gene="tbpA"
FT                   /locus_tag="E2348C_0074"
FT                   /product="thiamin transporter subunit TbpA"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07622"
FT                   /db_xref="GOA:B7UIB9"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIB9"
FT                   /protein_id="CAS07622.1"
FT                   /translation="MLKKCLPLLLLCTAPVFAKPVLTVYTYDSFAADWGPGPVVKKAFE
FT                   ADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLDAASKTGLFAKSGVAAE
FT                   AVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNPPQSLKELVESDQNWRVIYEDPRTSTP
FT                   GLGLLLWMQKVYGDNAPQAWQKLAKKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYH
FT                   ILEEKKDNYAATNFSEGHYLQVEVAARTAASKQPELAQKFLQFMVSPAFQNAIPTGNWM
FT                   YPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAWISEWQRAVSR"
     MLKKCLPLLL LCTAPVFAKP VLTVYTYDSF AADWGPGPVV KKAFEADCNC ELKLVALEDG        60
     VSLLNRLRME GKNSKADVVL GLDNNLLDAA SKTGLFAKSG VAAEAVNVPG GWNNDTFVPF       120
     DYGYFAFVYD KNKLKNPPQS LKELVESDQN WRVIYEDPRT STPGLGLLLW MQKVYGDNAP       180
     QAWQKLAKKT VTVTKGWSEA YGLFLKGESD LVLSYTTSPA YHILEEKKDN YAATNFSEGH       240
     YLQVEVAART AASKQPELAQ KFLQFMVSPA FQNAIPTGNW MYPVANVTLP AGFEQLTKPA       300
     TTLEFTPAEV AAQRQAWISE WQRAVSR                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page