(data stored in ACNUC7421 zone)

EMBL: FM180568.THIQ

FM180568.THIQ        Location/Qualifiers
FT   CDS             complement(79568..80266)
FT                   /transl_table=11
FT                   /gene="thiQ"
FT                   /locus_tag="E2348C_0072"
FT                   /product="thiamin transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07620"
FT                   /db_xref="GOA:B7UIB7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005968"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIB7"
FT                   /protein_id="CAS07620.1"
FT                   /translation="MLKLTDITWLYHHLPMRFSLTVERGEQVAILGPSGAGKSTLLNLI
FT                   AGFLTPASGSLTIDGVDHTTTPPSRRPVSMLFQENNLFSHLTVAQNIGLGLNPGLKLNA
FT                   AQQKKMHAIAHQMGIDNLMARLPGELSGGQRQRVALARCLVREQPILLLDEPFSALDPA
FT                   LRQEMLTLVSSSCQQQKMTLLMVSHSVEDAARIATRSVVVADGRIAWQGKTDELLSGKA
FT                   SASALLGIKG"
     MLKLTDITWL YHHLPMRFSL TVERGEQVAI LGPSGAGKST LLNLIAGFLT PASGSLTIDG        60
     VDHTTTPPSR RPVSMLFQEN NLFSHLTVAQ NIGLGLNPGL KLNAAQQKKM HAIAHQMGID       120
     NLMARLPGEL SGGQRQRVAL ARCLVREQPI LLLDEPFSAL DPALRQEMLT LVSSSCQQQK       180
     MTLLMVSHSV EDAARIATRS VVVADGRIAW QGKTDELLSG KASASALLGI KG               232
//

If you have problems or comments...

PBIL Back to PBIL home page