(data stored in ACNUC7421 zone)

EMBL: FM180568.TOLA

FM180568.TOLA        Location/Qualifiers
FT   CDS             690275..691477
FT                   /transl_table=11
FT                   /gene="tolA"
FT                   /locus_tag="E2348C_0623"
FT                   /product="membrane anchored protein TolA in TolA-TolQ-TolR
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0623"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08171"
FT                   /db_xref="GOA:B7ULL9"
FT                   /db_xref="InterPro:IPR014161"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULL9"
FT                   /protein_id="CAS08171.1"
FT                   /translation="MSKATEQNDKLKRAIIISAVLHVILFAALIWSSFDENIEASAGGG
FT                   GGSSIDAVMVDSGAVVEQYKRMQSQESSAKRSDEQRKMKEQQAAEELREKQAAEQERLK
FT                   QLEKERLAAQEQKKQAEEAAKQAELKQKQAEEAAAKAAADAKAKAEADAKAAEEAAKKA
FT                   AADAKKKAEAEAAKAAVEAQKKAEAAAAALKKKAEAAEAAAAEARKKAATEAAEKAKAE
FT                   AEKKAAAEKAAAEKAAADKKAAAEKAAADKKAAAAKAAAEKAAAAKAAAEADDIFGELS
FT                   SGKNAPKTGGGAKGNNASPAGSGNTKNNGASGADINNYAGQIKSAIESKFYDASSYAGK
FT                   TCTLRIKLAPDGMLLDIKPEGGDPALCQAALAAAKLAKIPKPPSQAVYEVFKNAPLDFK
FT                   P"
     MSKATEQNDK LKRAIIISAV LHVILFAALI WSSFDENIEA SAGGGGGSSI DAVMVDSGAV        60
     VEQYKRMQSQ ESSAKRSDEQ RKMKEQQAAE ELREKQAAEQ ERLKQLEKER LAAQEQKKQA       120
     EEAAKQAELK QKQAEEAAAK AAADAKAKAE ADAKAAEEAA KKAAADAKKK AEAEAAKAAV       180
     EAQKKAEAAA AALKKKAEAA EAAAAEARKK AATEAAEKAK AEAEKKAAAE KAAAEKAAAD       240
     KKAAAEKAAA DKKAAAAKAA AEKAAAAKAA AEADDIFGEL SSGKNAPKTG GGAKGNNASP       300
     AGSGNTKNNG ASGADINNYA GQIKSAIESK FYDASSYAGK TCTLRIKLAP DGMLLDIKPE       360
     GGDPALCQAA LAAAKLAKIP KPPSQAVYEV FKNAPLDFKP                             400
//

If you have problems or comments...

PBIL Back to PBIL home page