(data stored in ACNUC7421 zone)

EMBL: FM180568.TOLQ

FM180568.TOLQ        Location/Qualifiers
FT   CDS             689086..689778
FT                   /transl_table=11
FT                   /gene="tolQ"
FT                   /locus_tag="E2348C_0621"
FT                   /product="membrane spanning protein TolQ in TolA-TolQ-TolR
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0621"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08169"
FT                   /db_xref="GOA:B7ULL7"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULL7"
FT                   /protein_id="CAS08169.1"
FT                   /translation="MTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAA
FT                   AREAEAFEDKFWSGIELSRLYQESQGKRDNLSGSEQIFYSGFKEFVRLHRANSHAPEAV
FT                   VEGASRAMRISMNRELENLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQAT
FT                   LQMVAPGIAEALIATAIGLFAAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQAF
FT                   TVSESNKG"
     MTDMNILDLF LKASLLVKLI MLILIGFSIA SWAIIIQRTR ILNAAAREAE AFEDKFWSGI        60
     ELSRLYQESQ GKRDNLSGSE QIFYSGFKEF VRLHRANSHA PEAVVEGASR AMRISMNREL       120
     ENLETHIPFL GTVGSISPYI GLFGTVWGIM HAFIALGAVK QATLQMVAPG IAEALIATAI       180
     GLFAAIPAVM AYNRLNQRVN KLELNYDNFM EEFTAILHRQ AFTVSESNKG                  230
//

If you have problems or comments...

PBIL Back to PBIL home page