(data stored in ACNUC7421 zone)

EMBL: FM180568.TOLR

FM180568.TOLR        Location/Qualifiers
FT   CDS             689782..690210
FT                   /transl_table=11
FT                   /gene="tolR"
FT                   /locus_tag="E2348C_0622"
FT                   /product="membrane spanning protein TolR in TolA-TolQ-TolR
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0622"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08170"
FT                   /db_xref="GOA:B7ULL8"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULL8"
FT                   /protein_id="CAS08170.1"
FT                   /translation="MARARGRGRRDLKSEINIVPLLDVLLVLLLIFMATAPIITQSVEV
FT                   DLPDATESQAVSSNDNPPVIVEVSGIGQYTVVVEKDRLERLPPEQVVAEVSSRFKANPK
FT                   TVFLIGGAKDVPYDEIIKALNLLHSAGVKSVGLMTQPI"
     MARARGRGRR DLKSEINIVP LLDVLLVLLL IFMATAPIIT QSVEVDLPDA TESQAVSSND        60
     NPPVIVEVSG IGQYTVVVEK DRLERLPPEQ VVAEVSSRFK ANPKTVFLIG GAKDVPYDEI       120
     IKALNLLHSA GVKSVGLMTQ PI                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page