(data stored in ACNUC7421 zone)

EMBL: FM180568.XSEB

FM180568.XSEB        Location/Qualifiers
FT   CDS             complement(400005..400247)
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="E2348C_0357"
FT                   /product="exonuclease VII small subunit XseB"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07905"
FT                   /db_xref="GOA:B7UJP5"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UJP5"
FT                   /protein_id="CAS07905.1"
FT                   /translation="MPKKNEAPASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQL
FT                   ARQGQAKLQQAEQRVQILLSDNEDASLTPFTPDNE"
     MPKKNEAPAS FEKALSELEQ IVTRLESGDL PLEEALNEFE RGVQLARQGQ AKLQQAEQRV        60
     QILLSDNEDA SLTPFTPDNE                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page