(data stored in ACNUC7421 zone)

EMBL: FM180568.YAAA

FM180568.YAAA        Location/Qualifiers
FT   CDS             complement(5579..6355)
FT                   /transl_table=11
FT                   /gene="yaaA"
FT                   /locus_tag="E2348C_0006"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07554"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UI51"
FT                   /protein_id="CAS07554.1"
FT                   /translation="MLILISPAKTLDYQSPLTTTRYTLPELLDNAQQLIHEARKLTPPQ
FT                   ISSLMRISDKLAGINAARFHDWQPDFTPENARQAILAFKGDVYTGLQAETFSEDDFDFA
FT                   QQHLRMLSGLYGVLRPLDLMQPYRLEMGIRLENARGKDLYQFWGDIITNKLNEALAAQG
FT                   DNVVINLASDEYFKSVKPKKLNAEIIKPVFLDEKNGKFKIISFYAKKARGLMSRFIIEN
FT                   RLTKPEQLTGFNSEGYFFDEASSSNGELVFKRYEQR"
     MLILISPAKT LDYQSPLTTT RYTLPELLDN AQQLIHEARK LTPPQISSLM RISDKLAGIN        60
     AARFHDWQPD FTPENARQAI LAFKGDVYTG LQAETFSEDD FDFAQQHLRM LSGLYGVLRP       120
     LDLMQPYRLE MGIRLENARG KDLYQFWGDI ITNKLNEALA AQGDNVVINL ASDEYFKSVK       180
     PKKLNAEIIK PVFLDEKNGK FKIISFYAKK ARGLMSRFII ENRLTKPEQL TGFNSEGYFF       240
     DEASSSNGEL VFKRYEQR                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page