(data stored in ACNUC7421 zone)

EMBL: FM180568.YAAI

FM180568.YAAI        Location/Qualifiers
FT   CDS             complement(12836..13240)
FT                   /transl_table=11
FT                   /gene="yaaI"
FT                   /locus_tag="E2348C_0013"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07561"
FT                   /db_xref="InterPro:IPR020240"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UI58"
FT                   /protein_id="CAS07561.1"
FT                   /translation="MKSVITISASLAISLMLCCTAQANDHKILGVIAMPRNETNDLALK
FT                   LPVCRIVKRIQLSTDHGDLQLSGASVYFKATRSASQTLNIPSEIKEGQTTDWININSDN
FT                   DNKRCVSKITFSGHTVNSSDMATLKIIGDD"
     MKSVITISAS LAISLMLCCT AQANDHKILG VIAMPRNETN DLALKLPVCR IVKRIQLSTD        60
     HGDLQLSGAS VYFKATRSAS QTLNIPSEIK EGQTTDWINI NSDNDNKRCV SKITFSGHTV       120
     NSSDMATLKI IGDD                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page