(data stored in ACNUC7421 zone)

EMBL: FM180568.YAAW

FM180568.YAAW        Location/Qualifiers
FT   CDS             complement(12097..12810)
FT                   /transl_table=11
FT                   /gene="yaaW"
FT                   /locus_tag="E2348C_0012"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07560"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="InterPro:IPR025217"
FT                   /db_xref="UniProtKB/TrEMBL:B7UI57"
FT                   /protein_id="CAS07560.1"
FT                   /translation="MNVNYLNDSDLDFLQHCSEEQLANFARLLTHNEKGKTRLSSVLMR
FT                   NELFKSMEGHPERYRRNWQLIAGELQHFGGDSIANKLRGHGKLYRAILLDVSKRLKLKA
FT                   DKEMSTFEIEQQLLEQFLRNTWKKMDEEHKQEFLHAVDARVNELEELLPLLMKDKLLAK
FT                   GVSHLLSSQLTRILRTHAAMSVLGHGLLRGAGLGGPVGAALNGVKAVSGSAYRVTIPAV
FT                   LQIACLRRMVSATQV"
     MNVNYLNDSD LDFLQHCSEE QLANFARLLT HNEKGKTRLS SVLMRNELFK SMEGHPERYR        60
     RNWQLIAGEL QHFGGDSIAN KLRGHGKLYR AILLDVSKRL KLKADKEMST FEIEQQLLEQ       120
     FLRNTWKKMD EEHKQEFLHA VDARVNELEE LLPLLMKDKL LAKGVSHLLS SQLTRILRTH       180
     AAMSVLGHGL LRGAGLGGPV GAALNGVKAV SGSAYRVTIP AVLQIACLRR MVSATQV          237
//

If you have problems or comments...

PBIL Back to PBIL home page