(data stored in ACNUC7421 zone)

EMBL: FM180568.YAAX

FM180568.YAAX        Location/Qualifiers
FT   CDS             5233..5529
FT                   /transl_table=11
FT                   /gene="yaaX"
FT                   /locus_tag="E2348C_0005"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07553"
FT                   /db_xref="InterPro:IPR019638"
FT                   /db_xref="UniProtKB/TrEMBL:B7UI50"
FT                   /protein_id="CAS07553.1"
FT                   /translation="MKKMQSIVLALSLVLVAPMAAQAAEITLVPSVKLQIGDRDNRGYY
FT                   WDGGHWRDHGWWKQHYEWRGNRWHPHGPPPSPRHNKHNDHRGDHRPGPDKHHR"
     MKKMQSIVLA LSLVLVAPMA AQAAEITLVP SVKLQIGDRD NRGYYWDGGH WRDHGWWKQH        60
     YEWRGNRWHP HGPPPSPRHN KHNDHRGDHR PGPDKHHR                                98
//

If you have problems or comments...

PBIL Back to PBIL home page