(data stored in ACNUC7421 zone)

EMBL: FM180568.YAAY

FM180568.YAAY        Location/Qualifiers
FT   CDS             24110..24328
FT                   /transl_table=11
FT                   /gene="yaaY"
FT                   /locus_tag="E2348C_0024"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07572"
FT                   /db_xref="InterPro:IPR020105"
FT                   /db_xref="UniProtKB/TrEMBL:B7UI69"
FT                   /protein_id="CAS07572.1"
FT                   /translation="MCRHSLRSDGAGFYQLAGCEYSFSARKIAAGGQFLPMICAIAMKS
FT                   HFFLISVLNRRLTLTAVQGILGRFSLF"
     MCRHSLRSDG AGFYQLAGCE YSFSARKIAA GGQFLPMICA IAMKSHFFLI SVLNRRLTLT        60
     AVQGILGRFS LF                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page