(data stored in ACNUC7421 zone)

EMBL: FM180568.YABI

FM180568.YABI        Location/Qualifiers
FT   CDS             78690..79454
FT                   /transl_table=11
FT                   /gene="yabI"
FT                   /locus_tag="E2348C_0071"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07619"
FT                   /db_xref="GOA:B7UIB6"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIB6"
FT                   /protein_id="CAS07619.1"
FT                   /translation="MQALLEHFITQSTVYSLMAVVLVAFLESLALVGLILPGTVLMAGL
FT                   GALIGSGELSFWYAWLAGIIGCLMGDWISFWLGWRFKKPLHRWSFLKKNKALLDKTEHA
FT                   LHQHSMFTILVGRFVGPTRPLVPMVAGMLDLPVAKFITPNIIGCLLWPPFYFLPGILAG
FT                   AAIDIPAGMQSGEFKWLLLVTAVLLWVGGWLCWRLWRSGKATDRLSHYLSRGRLLWLTP
FT                   LISAIGVVALVVLIRHPLMPVYIDILRKVVGV"
     MQALLEHFIT QSTVYSLMAV VLVAFLESLA LVGLILPGTV LMAGLGALIG SGELSFWYAW        60
     LAGIIGCLMG DWISFWLGWR FKKPLHRWSF LKKNKALLDK TEHALHQHSM FTILVGRFVG       120
     PTRPLVPMVA GMLDLPVAKF ITPNIIGCLL WPPFYFLPGI LAGAAIDIPA GMQSGEFKWL       180
     LLVTAVLLWV GGWLCWRLWR SGKATDRLSH YLSRGRLLWL TPLISAIGVV ALVVLIRHPL       240
     MPVYIDILRK VVGV                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page