(data stored in ACNUC7421 zone)

EMBL: FM180568.YACG

FM180568.YACG        Location/Qualifiers
FT   CDS             complement(117646..117843)
FT                   /transl_table=11
FT                   /gene="yacG"
FT                   /locus_tag="E2348C_0105"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07653"
FT                   /db_xref="GOA:B7UIF0"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UIF0"
FT                   /protein_id="CAS07653.1"
FT                   /translation="MSETITVNCPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEK
FT                   RIPSSGDLSESDDWSEEPKQ"
     MSETITVNCP TCGKTVVWGE ISPFRPFCSK RCQLIDLGEW AAEEKRIPSS GDLSESDDWS        60
     EEPKQ                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page