(data stored in ACNUC7421 zone)

EMBL: FM180568.YACH

FM180568.YACH        Location/Qualifiers
FT   CDS             complement(135289..137142)
FT                   /transl_table=11
FT                   /gene="yacH"
FT                   /locus_tag="E2348C_0120"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07668"
FT                   /db_xref="InterPro:IPR021728"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIG5"
FT                   /protein_id="CAS07668.1"
FT                   /translation="MKMTLPFKPHVLALICSAGLCAASAGLYIKSRTVEAPVEAQSTQQ
FT                   TAPDISAVTLPATVSAPPVTPAVVKSTFSTAQIDQWVAPVALYPDSLLSQVLMASTYPA
FT                   NVAQAVQWSHDNPLKQGDAAIQAVSGQSWDASVKSLVAFPQLMALMGENPQWVQNLGDA
FT                   FLAQPQDVMDSVQRLRQLAQQTGSLKSSTEQKIITTTKKVVPVNQPANAPATQSNTVST
FT                   SSPVVAEPAPTVITIEPANPDVVYIPNYNPNVVYGSWANTAYPPVYLPPPAGEPFVDSF
FT                   VRGFGYSMGVATTYALFSSIDWDDDDHDHHHHDDDDYHHHDGGHRDGNDWQHNGDNINI
FT                   DVNNFNRITGEHLTDKNMAWQHNPNYRNGVPYHDQDMAKRFHQTDVNGGMSATQLPAPT
FT                   RDSQRHAAASQFQQRTHTAPVITRDTQRQAAAQRFNEAEHNGSYDDFRDFSRRQPLTQQ
FT                   QKDAARQRYQSASPEQRQAAREKMQTNPQNQQRREAARQRIQSAPPEQRQAVREKMQTN
FT                   PQNQQRREAARQRIQSASPEQRQVFKEKVQQRPLNQEQRDNARQRVQSASPEQRPFFRE
FT                   KVQESRPQRLNDSNRTARLNNEQRSTVRERLSERGARRLER"
     MKMTLPFKPH VLALICSAGL CAASAGLYIK SRTVEAPVEA QSTQQTAPDI SAVTLPATVS        60
     APPVTPAVVK STFSTAQIDQ WVAPVALYPD SLLSQVLMAS TYPANVAQAV QWSHDNPLKQ       120
     GDAAIQAVSG QSWDASVKSL VAFPQLMALM GENPQWVQNL GDAFLAQPQD VMDSVQRLRQ       180
     LAQQTGSLKS STEQKIITTT KKVVPVNQPA NAPATQSNTV STSSPVVAEP APTVITIEPA       240
     NPDVVYIPNY NPNVVYGSWA NTAYPPVYLP PPAGEPFVDS FVRGFGYSMG VATTYALFSS       300
     IDWDDDDHDH HHHDDDDYHH HDGGHRDGND WQHNGDNINI DVNNFNRITG EHLTDKNMAW       360
     QHNPNYRNGV PYHDQDMAKR FHQTDVNGGM SATQLPAPTR DSQRHAAASQ FQQRTHTAPV       420
     ITRDTQRQAA AQRFNEAEHN GSYDDFRDFS RRQPLTQQQK DAARQRYQSA SPEQRQAARE       480
     KMQTNPQNQQ RREAARQRIQ SAPPEQRQAV REKMQTNPQN QQRREAARQR IQSASPEQRQ       540
     VFKEKVQQRP LNQEQRDNAR QRVQSASPEQ RPFFREKVQE SRPQRLNDSN RTARLNNEQR       600
     STVRERLSER GARRLER                                                      617
//

If you have problems or comments...

PBIL Back to PBIL home page