(data stored in ACNUC7421 zone)

EMBL: FM180568.YADI

FM180568.YADI        Location/Qualifiers
FT   CDS             150303..150743
FT                   /transl_table=11
FT                   /gene="yadI"
FT                   /locus_tag="E2348C_0132"
FT                   /product="predicted PTS Enzyme IIA"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07680"
FT                   /db_xref="GOA:B7UIH7"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIH7"
FT                   /protein_id="CAS07680.1"
FT                   /translation="MLGWVITCHDDRAQEILDALEKKHGALLQCRAVNFWRGLSSNMLS
FT                   RMMCDALHETDSGEGAIFLTDIAGAPPYRVASLLSHKHSRCEVISGVTLPLIEQMMACR
FT                   ETMTSSAFREHIVELGAPEVSSLWHQQQKNPPFVLKHNLYEY"
     MLGWVITCHD DRAQEILDAL EKKHGALLQC RAVNFWRGLS SNMLSRMMCD ALHETDSGEG        60
     AIFLTDIAGA PPYRVASLLS HKHSRCEVIS GVTLPLIEQM MACRETMTSS AFREHIVELG       120
     APEVSSLWHQ QQKNPPFVLK HNLYEY                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page