(data stored in ACNUC7421 zone)

EMBL: FM180568.YADK

FM180568.YADK        Location/Qualifiers
FT   CDS             complement(156830..157426)
FT                   /transl_table=11
FT                   /gene="yadK"
FT                   /locus_tag="E2348C_0139"
FT                   /product="predicted fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07687"
FT                   /db_xref="GOA:B7UII3"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B7UII3"
FT                   /protein_id="CAS07687.1"
FT                   /translation="MRPTQRNLMKKSILLLSLLFSTTFPVVAGQDVDIVANIKNNTYQS
FT                   GISNNGNIDLGVVGVGDFTGNISAENYHPGGKDFTITVQDCTLQGTGNVLNQLHINFRA
FT                   LSGVMATGSSQIFANEDNAGAKNVGVVIFSIQDPANTFNVLSATGSARSVYPVMSSALN
FT                   NSSWKFSTRMQKIDPALNVTSGPLISHVLVDIYYE"
     MRPTQRNLMK KSILLLSLLF STTFPVVAGQ DVDIVANIKN NTYQSGISNN GNIDLGVVGV        60
     GDFTGNISAE NYHPGGKDFT ITVQDCTLQG TGNVLNQLHI NFRALSGVMA TGSSQIFANE       120
     DNAGAKNVGV VIFSIQDPAN TFNVLSATGS ARSVYPVMSS ALNNSSWKFS TRMQKIDPAL       180
     NVTSGPLISH VLVDIYYE                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page