(data stored in ACNUC7421 zone)

EMBL: FM180568.YADN

FM180568.YADN        Location/Qualifiers
FT   CDS             complement(162128..162718)
FT                   /transl_table=11
FT                   /gene="yadN"
FT                   /locus_tag="E2348C_0144"
FT                   /product="predicted fimbrial-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07692"
FT                   /db_xref="GOA:B7UII5"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B7UII5"
FT                   /protein_id="CAS07692.1"
FT                   /translation="MSKKLGFALSGIMLAMAAGTTFAANDMDGGQLNISGLVVDNTCEA
FT                   RVDGGNKDGLILLQTATVAEITDGVLDTTVGAKAKPFSITIDCSKANPAPGTTAKMTFG
FT                   SVFFGNSKGTLNNDMSINTPSDGVNIALHNIEGSTIKQVQVNNPGDVYSKTLDSTSKSA
FT                   TYDFKASYVRADASRAATAGYVKTNSAYTITYQ"
     MSKKLGFALS GIMLAMAAGT TFAANDMDGG QLNISGLVVD NTCEARVDGG NKDGLILLQT        60
     ATVAEITDGV LDTTVGAKAK PFSITIDCSK ANPAPGTTAK MTFGSVFFGN SKGTLNNDMS       120
     INTPSDGVNI ALHNIEGSTI KQVQVNNPGD VYSKTLDSTS KSATYDFKAS YVRADASRAA       180
     TAGYVKTNSA YTITYQ                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page