(data stored in ACNUC7421 zone)

EMBL: FM180568.YAEH

FM180568.YAEH        Location/Qualifiers
FT   CDS             complement(194433..194819)
FT                   /transl_table=11
FT                   /gene="yaeH"
FT                   /locus_tag="E2348C_0170"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07718"
FT                   /db_xref="InterPro:IPR020911"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UIL0"
FT                   /protein_id="CAS07718.1"
FT                   /translation="MYDNLKSLGITNPEEIDRYSLRQEANNDILKIYFQKDKGEFFAKS
FT                   VKFKYPRQRKTVVADGVGQGYKEVQEISPNLRYIIDELDQICQRDRSEVDLKRKILDDL
FT                   RHLESVVTNKISEIEADLEKLTRK"
     MYDNLKSLGI TNPEEIDRYS LRQEANNDIL KIYFQKDKGE FFAKSVKFKY PRQRKTVVAD        60
     GVGQGYKEVQ EISPNLRYII DELDQICQRD RSEVDLKRKI LDDLRHLESV VTNKISEIEA       120
     DLEKLTRK                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page