(data stored in ACNUC7421 zone)

EMBL: FM180568.YAEJ

FM180568.YAEJ        Location/Qualifiers
FT   CDS             224834..225256
FT                   /transl_table=11
FT                   /gene="yaeJ"
FT                   /locus_tag="E2348C_0197"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07745"
FT                   /db_xref="GOA:B7UJ93"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJ93"
FT                   /protein_id="CAS07745.1"
FT                   /translation="MIVISRHVAIPDGELEITAIRAQGAGGQHVNKTSTAIHLRFDIRA
FT                   SSLPEYYKERLLAASHHLISSDGVIVIKAQEYRNQELNREAALARLVAVIKDLTTEQKA
FT                   RRPTRPTRASKERRLASKAQKSSVKAMRGKVRSGRE"
     MIVISRHVAI PDGELEITAI RAQGAGGQHV NKTSTAIHLR FDIRASSLPE YYKERLLAAS        60
     HHLISSDGVI VIKAQEYRNQ ELNREAALAR LVAVIKDLTT EQKARRPTRP TRASKERRLA       120
     SKAQKSSVKA MRGKVRSGRE                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page