(data stored in ACNUC7421 zone)

EMBL: FM180568.YAEP

FM180568.YAEP        Location/Qualifiers
FT   CDS             complement(223926..224126)
FT                   /transl_table=11
FT                   /gene="yaeP"
FT                   /locus_tag="E2348C_0195"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07743"
FT                   /db_xref="InterPro:IPR009624"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UJ91"
FT                   /protein_id="CAS07743.1"
FT                   /translation="MEKYCELIRKRYAEIASGDLGYVPDALGCVLKVLNEMAADDALSE
FT                   AVREKAAYAAANLLVSDYVNE"
     MEKYCELIRK RYAEIASGDL GYVPDALGCV LKVLNEMAAD DALSEAVREK AAYAAANLLV        60
     SDYVNE                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page