(data stored in ACNUC7421 zone)

EMBL: FM180568.YAFK

FM180568.YAFK        Location/Qualifiers
FT   CDS             complement(252932..253672)
FT                   /transl_table=11
FT                   /gene="yafK"
FT                   /locus_tag="E2348C_0221"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07769"
FT                   /db_xref="GOA:B7UJB7"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJB7"
FT                   /protein_id="CAS07769.1"
FT                   /translation="MRKIALILAMLLIPCVSFAGLLGSSSSTTPVSKEYKQQLMGSPVY
FT                   IQIFKEERTLDLYVKMGEQYQLLDSYKICKYSGGLGPKQRQGDFKSPEGFYSVQRNQLK
FT                   PDSRYYKAINIGFPNAYDRAHGYEGKYLMIHGDCVSIGCYAMTNQGIDEIFQFVTGALV
FT                   FGQPSVQVSIYPFRMTDANMKRHKYSNFKDFWEQLKPGYDYFEQTRKPPTVSVVNGRYV
FT                   VSKPLSHEVVQPQLASNYTLPEAK"
     MRKIALILAM LLIPCVSFAG LLGSSSSTTP VSKEYKQQLM GSPVYIQIFK EERTLDLYVK        60
     MGEQYQLLDS YKICKYSGGL GPKQRQGDFK SPEGFYSVQR NQLKPDSRYY KAINIGFPNA       120
     YDRAHGYEGK YLMIHGDCVS IGCYAMTNQG IDEIFQFVTG ALVFGQPSVQ VSIYPFRMTD       180
     ANMKRHKYSN FKDFWEQLKP GYDYFEQTRK PPTVSVVNGR YVVSKPLSHE VVQPQLASNY       240
     TLPEAK                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page