(data stored in ACNUC7421 zone)

EMBL: FM180568.YAFP

FM180568.YAFP        Location/Qualifiers
FT   CDS             259114..259566
FT                   /transl_table=11
FT                   /gene="yafP"
FT                   /locus_tag="E2348C_0227"
FT                   /product="predicted acyltransferase with
FT                   acyl-CoAN-acyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07775"
FT                   /db_xref="GOA:B7UJC2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJC2"
FT                   /protein_id="CAS07775.1"
FT                   /translation="MNNIQIRNYQPGDFQQLCAIFIRAVTMTASQHYSPQQIAAWAQID
FT                   ESRWKEKLAKSQVRVAVINAQPVGFISRIEHYIDMLFVDPEYTLRGVASALLKPLIKSE
FT                   SELTVDASITAKPFFERYGFQTVKQQRVECRGAWFTNFYMRYKPQH"
     MNNIQIRNYQ PGDFQQLCAI FIRAVTMTAS QHYSPQQIAA WAQIDESRWK EKLAKSQVRV        60
     AVINAQPVGF ISRIEHYIDM LFVDPEYTLR GVASALLKPL IKSESELTVD ASITAKPFFE       120
     RYGFQTVKQQ RVECRGAWFT NFYMRYKPQH                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page