(data stored in ACNUC7421 zone)

EMBL: FM180568.YAHC

FM180568.YAHC        Location/Qualifiers
FT   CDS             complement(314171..314668)
FT                   /transl_table=11
FT                   /gene="yahC"
FT                   /locus_tag="E2348C_0279"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07827"
FT                   /db_xref="GOA:B7UJH0"
FT                   /db_xref="InterPro:IPR009476"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJH0"
FT                   /protein_id="CAS07827.1"
FT                   /translation="MNGLTATGVTVGICAGLWQLVSSHVGLSQGWELLGTIGFVAFCSF
FT                   YAAGGGKSGFIRSLAVNYSGMVWAFFAALAAGWLAPVSGISGVWASVITTVPFSAVVVW
FT                   QGRFWLLSFIPGGFLGMTLFFASGMNWTVTLLGFLAGNCVGIISEYGGQKLSEATTKRD
FT                   GY"
     MNGLTATGVT VGICAGLWQL VSSHVGLSQG WELLGTIGFV AFCSFYAAGG GKSGFIRSLA        60
     VNYSGMVWAF FAALAAGWLA PVSGISGVWA SVITTVPFSA VVVWQGRFWL LSFIPGGFLG       120
     MTLFFASGMN WTVTLLGFLA GNCVGIISEY GGQKLSEATT KRDGY                       165
//

If you have problems or comments...

PBIL Back to PBIL home page