(data stored in ACNUC7421 zone)

EMBL: FM180568.YAHD

FM180568.YAHD        Location/Qualifiers
FT   CDS             314926..315531
FT                   /transl_table=11
FT                   /gene="yahD"
FT                   /locus_tag="E2348C_0280"
FT                   /product="predicted transcriptional regulator with ankyrin
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07828"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJH1"
FT                   /protein_id="CAS07828.1"
FT                   /translation="MTIKNLPADYLLAAQQGDIDKVKTCLALGVDINTCERQGKTAITL
FT                   ASLYQQYACVQALIDAGANINKQDHTCLNPFLMSCLNDDLTLLRIILPAKPDLNCVTRF
FT                   GGVGLTPACEKGHLSIVKELLAHTEINVNQTNHVGWTPLLEAIVLNDGGIKQQAIVQLL
FT                   LEHGASPHLTDKYGKTPLELARERGFEEIAQLLIAAGA"
     MTIKNLPADY LLAAQQGDID KVKTCLALGV DINTCERQGK TAITLASLYQ QYACVQALID        60
     AGANINKQDH TCLNPFLMSC LNDDLTLLRI ILPAKPDLNC VTRFGGVGLT PACEKGHLSI       120
     VKELLAHTEI NVNQTNHVGW TPLLEAIVLN DGGIKQQAIV QLLLEHGASP HLTDKYGKTP       180
     LELARERGFE EIAQLLIAAG A                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page