(data stored in ACNUC7421 zone)

EMBL: FM180568.YAHG

FM180568.YAHG        Location/Qualifiers
FT   CDS             317971..319389
FT                   /transl_table=11
FT                   /gene="yahG"
FT                   /locus_tag="E2348C_0283"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07831"
FT                   /db_xref="InterPro:IPR009499"
FT                   /db_xref="InterPro:IPR024033"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJH4"
FT                   /protein_id="CAS07831.1"
FT                   /translation="MSQSLFSQPLNVINVGIAMFSDDLKKQHVEVTQLDWTPPGQGNMQ
FT                   VVQALDNIADSPLADKITAANQQALERIIQSHPVLIGFDQAINVVPGMTPKTILHAGPP
FT                   VTWEKMCGAMKGAVTGALVFEGLAKDLDEAAELAASGEITFSPCHEHDCVGSMAGVTSA
FT                   SMFMHIVKNKTYGNVAYTNMSEQMAKILRMGANDQSVIDRLNWMRDVQGPMLRDAMKII
FT                   GEIDLRLMLAQALHMGDECHNRNNAGTTLLIQALTPGIIQAGYSVEQQREVFEFVASSD
FT                   YFSGPTWMAMCKAAMDAAHGIEYSTVVTTMARNGVEFGLRVSGLPGQWFTGPAQQVIGP
FT                   MFAGYKPEDSGLDIGDSAITETYGIGGFAMATAPAIVALVGGTVEEAIDFSRQMREITL
FT                   SENPNVTIPLLGFMGVPSAIDITRVGSSGILPVINTAIAHKDAGVGMIGAGIVHPPFAC
FT                   FEKAILGWCERYGV"
     MSQSLFSQPL NVINVGIAMF SDDLKKQHVE VTQLDWTPPG QGNMQVVQAL DNIADSPLAD        60
     KITAANQQAL ERIIQSHPVL IGFDQAINVV PGMTPKTILH AGPPVTWEKM CGAMKGAVTG       120
     ALVFEGLAKD LDEAAELAAS GEITFSPCHE HDCVGSMAGV TSASMFMHIV KNKTYGNVAY       180
     TNMSEQMAKI LRMGANDQSV IDRLNWMRDV QGPMLRDAMK IIGEIDLRLM LAQALHMGDE       240
     CHNRNNAGTT LLIQALTPGI IQAGYSVEQQ REVFEFVASS DYFSGPTWMA MCKAAMDAAH       300
     GIEYSTVVTT MARNGVEFGL RVSGLPGQWF TGPAQQVIGP MFAGYKPEDS GLDIGDSAIT       360
     ETYGIGGFAM ATAPAIVALV GGTVEEAIDF SRQMREITLS ENPNVTIPLL GFMGVPSAID       420
     ITRVGSSGIL PVINTAIAHK DAGVGMIGAG IVHPPFACFE KAILGWCERY GV               472
//

If you have problems or comments...

PBIL Back to PBIL home page