(data stored in ACNUC7421 zone)

EMBL: FM180568.YAHI

FM180568.YAHI        Location/Qualifiers
FT   CDS             319719..320669
FT                   /transl_table=11
FT                   /gene="yahI"
FT                   /locus_tag="E2348C_0285"
FT                   /product="predicted carbamate kinase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07833"
FT                   /db_xref="GOA:B7UJH6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJH6"
FT                   /protein_id="CAS07833.1"
FT                   /translation="MKELVVVAIGGNSIIKDNASQSIEHQAEAVKAVADTVLEMLASDY
FT                   DIVLTHGNGPQVGLDLRRAEIAHEREGLPLTPLANCVADTQGGIGYLIQQALNNRLARH
FT                   GEKKAVTVVTQVEVDKNDPGFAHPTKPIGEFFSESQRDELQKANPDWRFVEDAGRGYRR
FT                   VVASPEPKRIVEAPAIKALIQQGFVVIGAGGGGIPVVRTDAGDYQSVDAVIDKDLSTAL
FT                   LAREIHADILVITTGVEKVCIHFGKPQQQALDRVDIATMTRYMQEGHFPPGSMLPKIIA
FT                   SLTFLEQGGKEVIITTPECLPAALRGETGTHIIKT"
     MKELVVVAIG GNSIIKDNAS QSIEHQAEAV KAVADTVLEM LASDYDIVLT HGNGPQVGLD        60
     LRRAEIAHER EGLPLTPLAN CVADTQGGIG YLIQQALNNR LARHGEKKAV TVVTQVEVDK       120
     NDPGFAHPTK PIGEFFSESQ RDELQKANPD WRFVEDAGRG YRRVVASPEP KRIVEAPAIK       180
     ALIQQGFVVI GAGGGGIPVV RTDAGDYQSV DAVIDKDLST ALLAREIHAD ILVITTGVEK       240
     VCIHFGKPQQ QALDRVDIAT MTRYMQEGHF PPGSMLPKII ASLTFLEQGG KEVIITTPEC       300
     LPAALRGETG THIIKT                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page