(data stored in ACNUC7421 zone)

EMBL: FM180568.YAHJ

FM180568.YAHJ        Location/Qualifiers
FT   CDS             320679..322061
FT                   /transl_table=11
FT                   /gene="yahJ"
FT                   /locus_tag="E2348C_0286"
FT                   /product="predicted deaminase with
FT                   metallo-dependenthydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07834"
FT                   /db_xref="GOA:B7UJH7"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJH7"
FT                   /protein_id="CAS07834.1"
FT                   /translation="MKENNSRREFLSQSGKMVTAAALFGPSVPLAHAGVAGTLNCEANN
FT                   TMKITDPYYYLDNVLLETGFDYENGVAVQTRTARQTVEIQDGKIVALRENKQHPDATLP
FT                   HYDAGGKLMLPTTRDMHIHLDKTFYGGPWRSLNRPAGTTIQDMIKLEQKMLPELQPYTQ
FT                   ERAEKLIDLLQSKGTTIARSHCNIEPVSGLKNLQNLQAVLARRQAGFECEIVAFPQHGL
FT                   LLSKSEPLMREAMQAGAHYVGGLDPTSVDGAMEKSLDTMFQIALDYDKGVDIHLHETTP
FT                   AGVAAINYMVETVEKTPQLKGKLTISHAFALATLNEQQVDELAHRMVAQQISIASTVPI
FT                   GTLHMPLKQLHDKGVKVMTGTDSVIDHWSPYGLGDMLEKANLYAQLYIRPNEQNLSRSL
FT                   FLATGDVLPLNEKGERVWPKAQDDASFVLVDASCSAEAVARISPRTATFHKGQLVWGSV
FT                   AG"
     MKENNSRREF LSQSGKMVTA AALFGPSVPL AHAGVAGTLN CEANNTMKIT DPYYYLDNVL        60
     LETGFDYENG VAVQTRTARQ TVEIQDGKIV ALRENKQHPD ATLPHYDAGG KLMLPTTRDM       120
     HIHLDKTFYG GPWRSLNRPA GTTIQDMIKL EQKMLPELQP YTQERAEKLI DLLQSKGTTI       180
     ARSHCNIEPV SGLKNLQNLQ AVLARRQAGF ECEIVAFPQH GLLLSKSEPL MREAMQAGAH       240
     YVGGLDPTSV DGAMEKSLDT MFQIALDYDK GVDIHLHETT PAGVAAINYM VETVEKTPQL       300
     KGKLTISHAF ALATLNEQQV DELAHRMVAQ QISIASTVPI GTLHMPLKQL HDKGVKVMTG       360
     TDSVIDHWSP YGLGDMLEKA NLYAQLYIRP NEQNLSRSLF LATGDVLPLN EKGERVWPKA       420
     QDDASFVLVD ASCSAEAVAR ISPRTATFHK GQLVWGSVAG                             460
//

If you have problems or comments...

PBIL Back to PBIL home page