(data stored in ACNUC7421 zone)

EMBL: FM180568.YAHO

FM180568.YAHO        Location/Qualifiers
FT   CDS             325185..325460
FT                   /transl_table=11
FT                   /gene="yahO"
FT                   /locus_tag="E2348C_0289"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07837"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJH9"
FT                   /protein_id="CAS07837.1"
FT                   /translation="MKIISKMLVGALAFAVTNVYAAELMTKAEFEKVASQYEKIGDIST
FT                   SNEMSTADAKEDLIKKADEKGADVLVLTSGQTDNKIHGTANIYKKK"
     MKIISKMLVG ALAFAVTNVY AAELMTKAEF EKVASQYEKI GDISTSNEMS TADAKEDLIK        60
     KADEKGADVL VLTSGQTDNK IHGTANIYKK K                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page