(data stored in ACNUC7421 zone)

EMBL: FM180568.YAIE

FM180568.YAIE        Location/Qualifiers
FT   CDS             367333..367617
FT                   /transl_table=11
FT                   /gene="yaiE"
FT                   /locus_tag="E2348C_0327"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07875"
FT                   /db_xref="GOA:B7UJL5"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UJL5"
FT                   /protein_id="CAS07875.1"
FT                   /translation="MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGEYTFSTAEPEEM
FT                   TVISGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVAEPTSYLCRYL"
     MLQSNEYFSG KVKSIGFSSS STGRASVGVM VEGEYTFSTA EPEEMTVISG ALNVLLPDAT        60
     DWQVYEAGSV FNVPGHSEFH LQVAEPTSYL CRYL                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page